SCOP 1.73: Domain d1ak4b_: 1ak4 B:

Lineage for d1ak4b_ (1ak4 B:)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.62: Cyclophilin-like [50890] (1 superfamily)
   barrel, closed; n=8, S=10; complex topology

4. Superfamily b.62.1: Cyclophilin-like [50891] (3 families)

5. Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (12 proteins)

6. Protein Cyclophilin (eukaryotic) [50893] (13 species)

7. Species Human (Homo sapiens), variant A [TaxId:9606] [50894] (48 PDB entries)

8. Domain d1ak4b_: 1ak4 B: [27473]
   Other proteins in same PDB: d1ak4c_, d1ak4d_
   mutant

Details for d1ak4b_

PDB Entry: 1ak4, 2.36 Å

PDB Description: human cyclophilin a bound to the amino-terminal domain of hiv-1 capsid

PDB Compounds: (B:) cyclophilin a

SCOP Domain Sequences for d1ak4b_:

Sequence; same for both SEQRES and ATOM records:

>d1ak4b_ b.62.1.1 (B:) Cyclophilin (eukaryotic) {Human (Homo sapiens), variant A [TaxId: 9606]}
nptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgfmc
qggdftrhngtggksiygekfedenfilkhtgpgilsmanagpntngsqffictaktewl
dgkhvvfgkvkegmniveamerfgsrngktskkitiadcgqle

Timeline for d1ak4b_:

• d1ak4b_ first appeared (with stable ids) in SCOP 1.55
  
• d1ak4b_ appears in SCOP 1.71
  
• d1ak4b_ appears in SCOP 1.75
  
• d1ak4b_ appears in the current release, SCOPe 2.08