Lineage for d5c92a1 (5c92 A:2-377)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2075644Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 2075645Superfamily b.69.1: Galactose oxidase, central domain [50965] (2 families) (S)
  5. 2075666Family b.69.1.0: automated matches [274715] (1 protein)
    not a true family
  6. 2075667Protein automated matches [274716] (1 species)
    not a true protein
  7. 2075668Species Colletotrichum graminicola [TaxId:645133] [274717] (2 PDB entries)
  8. 2075670Domain d5c92a1: 5c92 A:2-377 [274725]
    Other proteins in same PDB: d5c92a2
    automated match to d1gofa3
    complexed with act, cu1, nag

Details for d5c92a1

PDB Entry: 5c92 (more details), 2.1 Å

PDB Description: novel fungal alcohol oxidase with catalytic diversity among the aa5 family, in complex with copper
PDB Compounds: (A:) Kelch domain-containing protein

SCOPe Domain Sequences for d5c92a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5c92a1 b.69.1.0 (A:2-377) automated matches {Colletotrichum graminicola [TaxId: 645133]}
nvgkwgpmvkfpvvpvavalvpetgnllvwssgwpnrwttagngktytslynvntgnisd
aivqntqhdmfcpgtsldadgriivtggssaaktsvldfkkgesspwtplsnmqisrgyq
sscttsegkifviggsfsgagtrngevydpkantwtklagcpvkplvmqrgmfpdshawl
wswkngsvlqagpskkmnwydtkgtgsntpaglrgtdedsmcgvsvmydavagkiftygg
gkgytgydstsnahiltlgepgqavqvqklangkynrgfanavvmpdgkiwvvggmqkmw
lfsdttpqltpelfdpatgsftpttphtvprnyhstallmadatiwsgggglcgancken
hfdgqfwsppylfead

SCOPe Domain Coordinates for d5c92a1:

Click to download the PDB-style file with coordinates for d5c92a1.
(The format of our PDB-style files is described here.)

Timeline for d5c92a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5c92a2