Lineage for d5c86a2 (5c86 A:378-482)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2765063Superfamily b.1.18: E set domains [81296] (27 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2766140Family b.1.18.0: automated matches [191341] (1 protein)
    not a true family
  6. 2766141Protein automated matches [190226] (81 species)
    not a true protein
  7. 2766192Species Colletotrichum graminicola [TaxId:645133] [274719] (2 PDB entries)
  8. 2766193Domain d5c86a2: 5c86 A:378-482 [274720]
    Other proteins in same PDB: d5c86a1, d5c86a3
    automated match to d1gofa1

Details for d5c86a2

PDB Entry: 5c86 (more details), 1.51 Å

PDB Description: novel fungal alcohol oxidase with catalytic diversity among the aa5 family, apo form
PDB Compounds: (A:) Kelch domain-containing protein

SCOPe Domain Sequences for d5c86a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5c86a2 b.1.18.0 (A:378-482) automated matches {Colletotrichum graminicola [TaxId: 645133]}
gvtpakrpviqslsdtavragapititmqdagaytfsmirvsatthtvntdqrripldgq
dggdgksftvnvpndygvaipgyymlfamneagvpcvaqffkvtl

SCOPe Domain Coordinates for d5c86a2:

Click to download the PDB-style file with coordinates for d5c86a2.
(The format of our PDB-style files is described here.)

Timeline for d5c86a2: