Class b: All beta proteins [48724] (180 folds) |
Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies) consists of seven 4-stranded beta-sheet motifs; meander |
Superfamily b.69.1: Galactose oxidase, central domain [50965] (2 families) |
Family b.69.1.0: automated matches [274715] (1 protein) not a true family |
Protein automated matches [274716] (1 species) not a true protein |
Species Colletotrichum graminicola [TaxId:645133] [274717] (2 PDB entries) |
Domain d5c86a1: 5c86 A:2-377 [274718] Other proteins in same PDB: d5c86a2, d5c86a3 automated match to d1gofa3 |
PDB Entry: 5c86 (more details), 1.51 Å
SCOPe Domain Sequences for d5c86a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5c86a1 b.69.1.0 (A:2-377) automated matches {Colletotrichum graminicola [TaxId: 645133]} nvgkwgpmvkfpvvpvavalvpetgnllvwssgwpnrwttagngktytslynvntgnisd aivqntqhdmfcpgtsldadgriivtggssaaktsvldfkkgesspwtplsnmqisrgyq sscttsegkifviggsfsgagtrngevydpkantwtklagcpvkplvmqrgmfpdshawl wswkngsvlqagpskkmnwydtkgtgsntpaglrgtdedsmcgvsvmydavagkiftygg gkgytgydstsnahiltlgepgqavqvqklangkynrgfanavvmpdgkiwvvggmqkmw lfsdttpqltpelfdpatgsftpttphtvprnyhstallmadatiwsgggglcgancken hfdgqfwsppylfead
Timeline for d5c86a1: