Lineage for d5c4qb_ (5c4q B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2319937Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 2319938Superfamily a.29.2: Bromodomain [47370] (2 families) (S)
  5. 2320170Family a.29.2.0: automated matches [191428] (1 protein)
    not a true family
  6. 2320171Protein automated matches [190615] (14 species)
    not a true protein
  7. 2321478Species Leishmania donovani [TaxId:981087] [274710] (2 PDB entries)
  8. 2321480Domain d5c4qb_: 5c4q B: [274712]
    automated match to d1n72a_
    complexed with bmf, unx

Details for d5c4qb_

PDB Entry: 5c4q (more details), 1.93 Å

PDB Description: crystal structure analysis of bromodomain from leishmania donovani complexed with bromosporine
PDB Compounds: (B:) Bromodomain

SCOPe Domain Sequences for d5c4qb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5c4qb_ a.29.2.0 (B:) automated matches {Leishmania donovani [TaxId: 981087]}
dvskrpreefhkeqclsfvkklwaadtlamfhypvsatevpgyydvvdtpmdlstirkni
eqgkyrtdtevendvvlmlsnaldfnekgsqwhdlakqlkkryltlaqesglsf

SCOPe Domain Coordinates for d5c4qb_:

Click to download the PDB-style file with coordinates for d5c4qb_.
(The format of our PDB-style files is described here.)

Timeline for d5c4qb_: