Lineage for d5c0of_ (5c0o F:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2129295Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2129296Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2130608Family c.66.1.0: automated matches [191451] (1 protein)
    not a true family
  6. 2130609Protein automated matches [190689] (64 species)
    not a true protein
  7. 2130936Species Thermus thermophilus [TaxId:262724] [231176] (3 PDB entries)
  8. 2130940Domain d5c0of_: 5c0o F: [274709]
    automated match to d2pwya_
    complexed with sam, so4; mutant

Details for d5c0of_

PDB Entry: 5c0o (more details), 2.62 Å

PDB Description: m1a58 trna methyltransferase mutant - y78a
PDB Compounds: (F:) tRNA (adenine(58)-N(1))-methyltransferase TrmI

SCOPe Domain Sequences for d5c0of_:

Sequence, based on SEQRES records: (download)

>d5c0of_ c.66.1.0 (F:) automated matches {Thermus thermophilus [TaxId: 262724]}
plllkdrkgraylvfpkeggvfhhhkgsvphealleagpggvvrthlgeelsvhrptlee
yllhmkrsatptapkdasamvtlldlapgmrvleagtgsggltlflaravgekglvesye
arphhlaqaernvrafwqvenvrfhlgkleeaeleeaaydgvaldlmepwkvlekaalal
kpdrflvaylpnitqvlelvraaeahpfrlervlevgwrewevrlpvahprfqqvghtaf
lvalrrwk

Sequence, based on observed residues (ATOM records): (download)

>d5c0of_ c.66.1.0 (F:) automated matches {Thermus thermophilus [TaxId: 262724]}
plllkdrkgraylvfpkeggvfsvphealleagpggvvrthlgeelsvhrptleeyllhm
ktptapkdasamvtlldlapgmrvleagtgsggltlflaravgekglvesyearphhlaq
aernvrafwqvenvrfhlgkleaaydgvaldlmepwkvlaalalkpdrflvaylpnitqv
lelvraaeahpfrlervlevgwrewevrlpvahprfqqvghtaflvalrrwk

SCOPe Domain Coordinates for d5c0of_:

Click to download the PDB-style file with coordinates for d5c0of_.
(The format of our PDB-style files is described here.)

Timeline for d5c0of_: