![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
![]() | Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) ![]() |
![]() | Family c.66.1.0: automated matches [191451] (1 protein) not a true family |
![]() | Protein automated matches [190689] (87 species) not a true protein |
![]() | Species Thermus thermophilus [TaxId:262724] [231176] (3 PDB entries) |
![]() | Domain d5c0oe_: 5c0o E: [274708] automated match to d2pwya_ complexed with sam, so4; mutant |
PDB Entry: 5c0o (more details), 2.62 Å
SCOPe Domain Sequences for d5c0oe_:
Sequence, based on SEQRES records: (download)
>d5c0oe_ c.66.1.0 (E:) automated matches {Thermus thermophilus [TaxId: 262724]} gplllkdrkgraylvfpkeggvfhhhkgsvphealleagpggvvrthlgeelsvhrptle eyllhmkrsatptapkdasamvtlldlapgmrvleagtgsggltlflaravgekglvesy earphhlaqaernvrafwqvenvrfhlgkleeaeleeaaydgvaldlmepwkvlekaala lkpdrflvaylpnitqvlelvraaeahpfrlervlevgwrewevrlpvahprfqqvghta flvalrrwka
>d5c0oe_ c.66.1.0 (E:) automated matches {Thermus thermophilus [TaxId: 262724]} gplllkdrkgraylvfpkeggvfvphealleagpggvvelsvhrptleeyllhmkrsatp tapkdasamvtlldlapgmrvleagtgsggltlflaravgekglvesyearphhlaqaer nvrafwqvenvrfhlgkleeaeleeaaydgvaldlmepwkvlekaalalkpdrflvaylp nitqvlelvraaeahpfrlervlevgwrewevrlpvahprfqqvghtaflvalrrwka
Timeline for d5c0oe_: