Lineage for d5bo4p2 (5bo4 P:149-198)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2738872Fold a.271: SOCS box-like [158234] (1 superfamily)
    helix-loop-helix motif with orthogonally packed helices
  4. 2738873Superfamily a.271.1: SOCS box-like [158235] (2 families) (S)
  5. 2738874Family a.271.1.1: SOCS box-like [158236] (2 proteins)
    Pfam PF07525
  6. 2738875Protein Suppressor of cytokine signaling 2, SOCS-2 [158239] (1 species)
  7. 2738876Species Human (Homo sapiens) [TaxId:9606] [158240] (2 PDB entries)
    Uniprot O14508 149-198
  8. 2738883Domain d5bo4p2: 5bo4 P:149-198 [274704]
    Other proteins in same PDB: d5bo4a1, d5bo4a3, d5bo4b_, d5bo4c1, d5bo4c2, d5bo4d1, d5bo4d3, d5bo4e_, d5bo4f_, d5bo4g1, d5bo4g3, d5bo4h_, d5bo4i1, d5bo4i2, d5bo4j1, d5bo4j3, d5bo4k_, d5bo4l1, d5bo4l2, d5bo4m1, d5bo4o_, d5bo4p1, d5bo4q_, d5bo4r_
    automated match to d2c9wa1

Details for d5bo4p2

PDB Entry: 5bo4 (more details), 2.9 Å

PDB Description: structure of socs2:elongin c:elongin b from dmso-treated crystals
PDB Compounds: (P:) suppressor of cytokine signaling 2

SCOPe Domain Sequences for d5bo4p2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5bo4p2 a.271.1.1 (P:149-198) Suppressor of cytokine signaling 2, SOCS-2 {Human (Homo sapiens) [TaxId: 9606]}
hlyltkplytsapslqhlcrltinkctgaiwglplptrlkdyleeykfqv

SCOPe Domain Coordinates for d5bo4p2:

Click to download the PDB-style file with coordinates for d5bo4p2.
(The format of our PDB-style files is described here.)

Timeline for d5bo4p2: