SCOPe 2.08: Domain d5bo4m2: 5bo4 M:149-198

Lineage for d5bo4m2 (5bo4 M:149-198)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.271: SOCS box-like [158234] (1 superfamily)
   helix-loop-helix motif with orthogonally packed helices

4. Superfamily a.271.1: SOCS box-like [158235] (2 families)

5. Family a.271.1.1: SOCS box-like [158236] (2 proteins)
   Pfam PF07525

6. Protein Suppressor of cytokine signaling 2, SOCS-2 [158239] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [158240] (2 PDB entries)
   Uniprot O14508 149-198

8. Domain d5bo4m2: 5bo4 M:149-198 [274701]
   Other proteins in same PDB: d5bo4a1, d5bo4a3, d5bo4b_, d5bo4c1, d5bo4c2, d5bo4d1, d5bo4d3, d5bo4e_, d5bo4f_, d5bo4g1, d5bo4g3, d5bo4h_, d5bo4i1, d5bo4i2, d5bo4j1, d5bo4j3, d5bo4k_, d5bo4l1, d5bo4l2, d5bo4m1, d5bo4o_, d5bo4p1, d5bo4q_, d5bo4r_
   automated match to d2c9wa1

Details for d5bo4m2

PDB Entry: 5bo4, 2.9 Å

PDB Description: structure of socs2:elongin c:elongin b from dmso-treated crystals

PDB Compounds: (M:) suppressor of cytokine signaling 2

SCOPe Domain Sequences for d5bo4m2:

Sequence; same for both SEQRES and ATOM records:

>d5bo4m2 a.271.1.1 (M:149-198) Suppressor of cytokine signaling 2, SOCS-2 {Human (Homo sapiens) [TaxId: 9606]}
hlyltkplytsapslqhlcrltinkctgaiwglplptrlkdyleeykfqv

Timeline for d5bo4m2:

• d5bo4m2 first appeared in SCOPe 2.05
  
• d5bo4m2 appears in SCOPe 2.07