Lineage for d1awrf_ (1awr F:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1553283Fold b.62: Cyclophilin-like [50890] (1 superfamily)
    barrel, closed; n=8, S=10; complex topology
  4. 1553284Superfamily b.62.1: Cyclophilin-like [50891] (5 families) (S)
  5. 1553285Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (13 proteins)
    automatically mapped to Pfam PF00160
  6. 1553286Protein Cyclophilin (eukaryotic) [50893] (13 species)
  7. 1553301Species Human (Homo sapiens), variant A [TaxId:9606] [50894] (58 PDB entries)
    Uniprot P05092
  8. 1553388Domain d1awrf_: 1awr F: [27469]

Details for d1awrf_

PDB Entry: 1awr (more details), 1.58 Å

PDB Description: cypa complexed with hagpia
PDB Compounds: (F:) cyclophilin a

SCOPe Domain Sequences for d1awrf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1awrf_ b.62.1.1 (F:) Cyclophilin (eukaryotic) {Human (Homo sapiens), variant A [TaxId: 9606]}
vnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgfm
cqggdftrhngtggksiygekfedenfilkhtgpgilsmanagpntngsqffictaktew
ldgkhvvfgkvkegmniveamerfgsrngktskkitiadcgqle

SCOPe Domain Coordinates for d1awrf_:

Click to download the PDB-style file with coordinates for d1awrf_.
(The format of our PDB-style files is described here.)

Timeline for d1awrf_: