Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.20: UBC-like [54494] (1 superfamily) alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2 |
Superfamily d.20.1: UBC-like [54495] (5 families) |
Family d.20.1.1: UBC-related [54496] (7 proteins) |
Protein automated matches [190124] (13 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [186848] (52 PDB entries) |
Domain d5aiub1: 5aiu B:4-151 [274672] Other proteins in same PDB: d5aiub2, d5aiuc_, d5aiue2, d5aiuf_ automated match to d3w31b_ complexed with edo, zn |
PDB Entry: 5aiu (more details), 2.21 Å
SCOPe Domain Sequences for d5aiub1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5aiub1 d.20.1.1 (B:4-151) automated matches {Human (Homo sapiens) [TaxId: 9606]} lprriiketqrllaepvpgikaepdesnaryfhvviagpqdspfeggtfklelflpeeyp maapkvrfmtkiyhpnvdklgrikldiladkwspalqirtvllsiqallsapnpddplan dvaeqwktneaqaietarawtrlyamnn
Timeline for d5aiub1:
View in 3D Domains from other chains: (mouse over for more information) d5aiuc_, d5aiue1, d5aiue2, d5aiuf_ |