SCOPe 2.08: Domain d5aiub1: 5aiu B:4-151

Lineage for d5aiub1 (5aiu B:4-151)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.20: UBC-like [54494] (1 superfamily)
   alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2

4. Superfamily d.20.1: UBC-like [54495] (5 families)

5. Family d.20.1.1: UBC-related [54496] (7 proteins)

6. Protein automated matches [190124] (13 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186848] (52 PDB entries)

8. Domain d5aiub1: 5aiu B:4-151 [274672]
   Other proteins in same PDB: d5aiub2, d5aiuc_, d5aiue2, d5aiuf_
   automated match to d3w31b_
   complexed with edo, zn

Details for d5aiub1

PDB Entry: 5aiu, 2.21 Å

PDB Description: a complex of rnf4-ring domain, ubc13-ub (isopeptide crosslink)

PDB Compounds: (B:) Ubiquitin-conjugating enzyme E2 N

SCOPe Domain Sequences for d5aiub1:

Sequence; same for both SEQRES and ATOM records:

>d5aiub1 d.20.1.1 (B:4-151) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lprriiketqrllaepvpgikaepdesnaryfhvviagpqdspfeggtfklelflpeeyp
maapkvrfmtkiyhpnvdklgrikldiladkwspalqirtvllsiqallsapnpddplan
dvaeqwktneaqaietarawtrlyamnn

Timeline for d5aiub1:

• d5aiub1 first appeared in SCOPe 2.05, called d5aiub_
  
• d5aiub1 appears in SCOPe 2.07