Lineage for d5a5zc1 (5a5z C:37-270)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2231215Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 2231216Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) (S)
  5. 2231713Family d.157.1.0: automated matches [191360] (1 protein)
    not a true family
  6. 2231714Protein automated matches [190418] (18 species)
    not a true protein
  7. 2231748Species Klebsiella pneumoniae [TaxId:573] [189718] (37 PDB entries)
  8. 2231826Domain d5a5zc1: 5a5z C:37-270 [274671]
    Other proteins in same PDB: d5a5za2, d5a5zc2
    automated match to d4eyba_
    complexed with wjz, zn

Details for d5a5zc1

PDB Entry: 5a5z (more details), 2.6 Å

PDB Description: approved drugs containing thiols as inhibitors of metallo-beta- lactamases: strategy to combat multidrug-resistant bacteria
PDB Compounds: (C:) Beta-lactamase NDM-1

SCOPe Domain Sequences for d5a5zc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5a5zc1 d.157.1.0 (C:37-270) automated matches {Klebsiella pneumoniae [TaxId: 573]}
qqmetgdqrfgdlvfrqlapnvwqhtsyldmpgfgavasnglivrdggrvlvvdtawtdd
qtaqilnwikqeinlpvalavvthahqdkmggmdalhaagiatyanalsnqlapqegmva
aqhsltfaangwvepatapnfgplkvfypgpghtsdnitvgidgtdiafggclikdskak
slgnlgdadtehyaasarafgaafpkasmivmshsapdsraaithtarmadklr

SCOPe Domain Coordinates for d5a5zc1:

Click to download the PDB-style file with coordinates for d5a5zc1.
(The format of our PDB-style files is described here.)

Timeline for d5a5zc1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5a5zc2