![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
![]() | Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) ![]() |
![]() | Family b.29.1.0: automated matches [191363] (1 protein) not a true family |
![]() | Protein automated matches [190437] (70 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187655] (109 PDB entries) |
![]() | Domain d4ym3d_: 4ym3 D: [274669] automated match to d2zhma_ |
PDB Entry: 4ym3 (more details), 1.89 Å
SCOPe Domain Sequences for d4ym3d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ym3d_ b.29.1.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]} gpptfnppvpyfgrlqggltarrtiiikgyvpptgksfainfkvgssgdialhinprmgn gtvvrnsllngswgseekkithnpfgpgqffdlsircgldrfkvyangqhlfdfahrlsa fqrvdtleiqgdvtlsyvqi
Timeline for d4ym3d_: