Lineage for d1awrc_ (1awr C:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.62: Cyclophilin-like [50890] (1 superfamily)
    barrel, closed; n=8, S=10; complex topology
  4. Superfamily b.62.1: Cyclophilin-like [50891] (5 families) (S)
  5. Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (13 proteins)
    automatically mapped to Pfam PF00160
  6. Protein Cyclophilin (eukaryotic) [50893] (13 species)
  7. Species Human (Homo sapiens), variant A [TaxId:9606] [50894] (136 PDB entries)
    Uniprot P05092
  8. Domain d1awrc_: 1awr C: [27466]

Details for d1awrc_

PDB Entry: 1awr (more details), 1.58 Å

PDB Description: cypa complexed with hagpia
PDB Compounds: (C:) cyclophilin a

SCOPe Domain Sequences for d1awrc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1awrc_ b.62.1.1 (C:) Cyclophilin (eukaryotic) {Human (Homo sapiens), variant A [TaxId: 9606]}
vnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgfm
cqggdftrhngtggksiygekfedenfilkhtgpgilsmanagpntngsqffictaktew
ldgkhvvfgkvkegmniveamerfgsrngktskkitiadcgqle

SCOPe Domain Coordinates for d1awrc_ are not available.

Timeline for d1awrc_:

Domains from other chains:
(mouse over for more information)
d1awra_, d1awrb_, d1awrd_, d1awre_, d1awrf_