Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (17 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187221] (1235 PDB entries) |
Domain d4zffl2: 4zff L:107-212 [274655] Other proteins in same PDB: d4zffb1, d4zffc_, d4zffd_, d4zffl1 automated match to d1dn0a2 complexed with so4 |
PDB Entry: 4zff (more details), 2.75 Å
SCOPe Domain Sequences for d4zffl2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4zffl2 b.1.1.2 (L:107-212) automated matches {Human (Homo sapiens) [TaxId: 9606]} krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrg
Timeline for d4zffl2:
View in 3D Domains from other chains: (mouse over for more information) d4zffb1, d4zffb2, d4zffc_, d4zffd_ |