Lineage for d4y0pa_ (4y0p A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2062521Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 2062522Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 2062523Family b.60.1.1: Retinol binding protein-like [50815] (22 protein domains)
    barrel, closed; n=8, S=12, meander
  6. 2062546Protein beta-Lactoglobulin [50827] (4 species)
  7. 2062547Species Cow (Bos taurus) [TaxId:9913] [50828] (56 PDB entries)
    Uniprot P02754
  8. 2062587Domain d4y0pa_: 4y0p A: [274650]
    automated match to d1bsqa_
    complexed with te4

Details for d4y0pa_

PDB Entry: 4y0p (more details), 2.2 Å

PDB Description: bovine beta-lactoglobulin complex with tetracaine (blg-tet)
PDB Compounds: (A:) beta-lactoglobulin

SCOPe Domain Sequences for d4y0pa_:

Sequence, based on SEQRES records: (download)

>d4y0pa_ b.60.1.1 (A:) beta-Lactoglobulin {Cow (Bos taurus) [TaxId: 9913]}
livtqtmkgldiqkvagtwyslamaasdislldaqsaplrvyveelkptpegdleillqk
wengecaqkkiiaektkipavfkidalnenkvlvldtdykkyllfcmensaepeqslacq
clvrtpevddealekfdkalkalpmhirlsfnptqleeqchi

Sequence, based on observed residues (ATOM records): (download)

>d4y0pa_ b.60.1.1 (A:) beta-Lactoglobulin {Cow (Bos taurus) [TaxId: 9913]}
livtqtmkgldiqkvagtwyslamaasdislldaqsaplrvyveelkptpegdleillqk
wengecaqkkiiaektkipavfkidalnenkvlvldtdykkyllfcmensaqslacqclv
rtpevddealekfdkalkalpmhirlsfnptqleeqchi

SCOPe Domain Coordinates for d4y0pa_:

Click to download the PDB-style file with coordinates for d4y0pa_.
(The format of our PDB-style files is described here.)

Timeline for d4y0pa_: