Lineage for d3x0ga_ (3x0g A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2733570Fold a.135: Tetraspanin [48651] (1 superfamily)
    5 helices: irregular disulfide-linked array; form homodimer
  4. 2733571Superfamily a.135.1: Tetraspanin [48652] (1 family) (S)
  5. 2733572Family a.135.1.1: Tetraspanin [48653] (2 proteins)
  6. 2733579Protein automated matches [256548] (3 species)
    not a true protein
  7. 2733580Species Chlorocebus sabaeus [TaxId:60711] [274648] (1 PDB entry)
  8. 2733581Domain d3x0ga_: 3x0g A: [274649]
    automated match to d4bkha_
    complexed with mpd

Details for d3x0ga_

PDB Entry: 3x0g (more details), 1.9 Å

PDB Description: crystal structure of the ectodomain of african green monkey cd81 large extracellular loop (agmcd81-lel)
PDB Compounds: (A:) cd81

SCOPe Domain Sequences for d3x0ga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3x0ga_ a.135.1.1 (A:) automated matches {Chlorocebus sabaeus [TaxId: 60711]}
shmfvnkdqiakdvkqfydqalqqavvdddannakavvktfhetvdccgsstlaalttsv
lknnlcpsgsniisnllkkdchqkiddffsgkl

SCOPe Domain Coordinates for d3x0ga_:

Click to download the PDB-style file with coordinates for d3x0ga_.
(The format of our PDB-style files is described here.)

Timeline for d3x0ga_: