| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.135: Tetraspanin [48651] (1 superfamily) 5 helices: irregular disulfide-linked array; form homodimer |
Superfamily a.135.1: Tetraspanin [48652] (1 family) ![]() |
| Family a.135.1.1: Tetraspanin [48653] (2 proteins) |
| Protein automated matches [256548] (3 species) not a true protein |
| Species Chlorocebus sabaeus [TaxId:60711] [274648] (1 PDB entry) |
| Domain d3x0ga_: 3x0g A: [274649] automated match to d4bkha_ complexed with mpd |
PDB Entry: 3x0g (more details), 1.9 Å
SCOPe Domain Sequences for d3x0ga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3x0ga_ a.135.1.1 (A:) automated matches {Chlorocebus sabaeus [TaxId: 60711]}
shmfvnkdqiakdvkqfydqalqqavvdddannakavvktfhetvdccgsstlaalttsv
lknnlcpsgsniisnllkkdchqkiddffsgkl
Timeline for d3x0ga_: