Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) many members have left-handed crossover connection between strand 8 and additional strand 9 |
Family c.69.1.0: automated matches [191404] (1 protein) not a true family |
Protein automated matches [190543] (124 species) not a true protein |
Species Rhizomucor miehei [TaxId:4839] [274645] (1 PDB entry) |
Domain d4wy5a_: 4wy5 A: [274647] automated match to d1jjia_ complexed with so4 |
PDB Entry: 4wy5 (more details), 2.43 Å
SCOPe Domain Sequences for d4wy5a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4wy5a_ c.69.1.0 (A:) automated matches {Rhizomucor miehei [TaxId: 4839]} gnppihpvyaaafaamkerppihtldlkvvressearqlaaniklpevieedkvvesdgk tlkltivrppgtedqilpvliflhgggfvfgskythikpvrdltvkanvvtvfvdyslsp eakfptaieeiyaailwvrenasslninaealavagdsagatlsaavsiyakekglsaai ktqvliypatavshakyesyklfgngdyilsaedlkffsnaylpapaselndklatlela tkadleglppallftaesdvlrdegekyaqqlaeagvdvaavrvlgavhgfitvpvetpq yrftintivahlrdiyakyn
Timeline for d4wy5a_: