SCOPe 2.06: Domain d4wy5a_: 4wy5 A:

Lineage for d4wy5a_ (4wy5 A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.0: automated matches [191404] (1 protein)
   not a true family

6. Protein automated matches [190543] (91 species)
   not a true protein

7. Species Rhizomucor miehei [TaxId:4839] [274645] (1 PDB entry)

8. Domain d4wy5a_: 4wy5 A: [274647]
   automated match to d1jjia_
   complexed with so4

Details for d4wy5a_

PDB Entry: 4wy5, 2.43 Å

PDB Description: structural analysis of two fungal esterases from rhizomucor miehei explaining their substrate specificity

PDB Compounds: (A:) esterase

SCOPe Domain Sequences for d4wy5a_:

Sequence; same for both SEQRES and ATOM records:

>d4wy5a_ c.69.1.0 (A:) automated matches {Rhizomucor miehei [TaxId: 4839]}
gnppihpvyaaafaamkerppihtldlkvvressearqlaaniklpevieedkvvesdgk
tlkltivrppgtedqilpvliflhgggfvfgskythikpvrdltvkanvvtvfvdyslsp
eakfptaieeiyaailwvrenasslninaealavagdsagatlsaavsiyakekglsaai
ktqvliypatavshakyesyklfgngdyilsaedlkffsnaylpapaselndklatlela
tkadleglppallftaesdvlrdegekyaqqlaeagvdvaavrvlgavhgfitvpvetpq
yrftintivahlrdiyakyn

Timeline for d4wy5a_:

• d4wy5a_ first appeared in SCOPe 2.05
  
• d4wy5a_ appears in SCOPe 2.07
  
• d4wy5a_ appears in the current release, SCOPe 2.08