Lineage for d4wy5b_ (4wy5 B:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2150568Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2150569Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2152713Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 2152714Protein automated matches [190543] (91 species)
    not a true protein
  7. 2153418Species Rhizomucor miehei [TaxId:4839] [274645] (1 PDB entry)
  8. 2153420Domain d4wy5b_: 4wy5 B: [274646]
    automated match to d1jjia_
    complexed with so4

Details for d4wy5b_

PDB Entry: 4wy5 (more details), 2.43 Å

PDB Description: structural analysis of two fungal esterases from rhizomucor miehei explaining their substrate specificity
PDB Compounds: (B:) esterase

SCOPe Domain Sequences for d4wy5b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4wy5b_ c.69.1.0 (B:) automated matches {Rhizomucor miehei [TaxId: 4839]}
gnppihpvyaaafaamkerppihtldlkvvressearqlaaniklpevieedkvvesdgk
tlkltivrppgtedqilpvliflhgggfvfgskythikpvrdltvkanvvtvfvdyslsp
eakfptaieeiyaailwvrenasslninaealavagdsagatlsaavsiyakekglsaai
ktqvliypatavshakyesyklfgngdyilsaedlkffsnaylpapaselndklatlela
tkadleglppallftaesdvlrdegekyaqqlaeagvdvaavrvlgavhgfitvpvetpq
yrftintivahlrdiyakyn

SCOPe Domain Coordinates for d4wy5b_:

Click to download the PDB-style file with coordinates for d4wy5b_.
(The format of our PDB-style files is described here.)

Timeline for d4wy5b_: