Lineage for d3wwta_ (3wwt A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1741149Fold a.90: Transcription factor STAT-4 N-domain [48091] (1 superfamily)
    multihelical; can be divided into two subdomains
  4. 1741150Superfamily a.90.1: Transcription factor STAT-4 N-domain [48092] (2 families) (S)
    automatically mapped to Pfam PF02865
  5. 1741155Family a.90.1.0: automated matches [274641] (1 protein)
    not a true family
  6. 1741156Protein automated matches [274642] (2 species)
    not a true protein
  7. 1741157Species Homo sapiens [TaxId:9606] [274643] (1 PDB entry)
  8. 1741158Domain d3wwta_: 3wwt A: [274644]
    automated match to d1bgfa_
    complexed with ca

Details for d3wwta_

PDB Entry: 3wwt (more details), 2 Å

PDB Description: crystal structure of the y3:stat1nd complex
PDB Compounds: (A:) signal transducer and activator of transcription 1-alpha/beta

SCOPe Domain Sequences for d3wwta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wwta_ a.90.1.0 (A:) automated matches {Homo sapiens [TaxId: 9606]}
msqwyelqqldskfleqvhqlyddsfpmeirqylaqwlekqdwehaandvsfatirfhdl
lsqlddqysrfslennfllqhnirkskrnlqdnfqedpiqmsmiiysclkeerkilenaq
rfn

SCOPe Domain Coordinates for d3wwta_:

Click to download the PDB-style file with coordinates for d3wwta_.
(The format of our PDB-style files is described here.)

Timeline for d3wwta_: