![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.90: Transcription factor STAT-4 N-domain [48091] (1 superfamily) multihelical; can be divided into two subdomains |
![]() | Superfamily a.90.1: Transcription factor STAT-4 N-domain [48092] (2 families) ![]() automatically mapped to Pfam PF02865 |
![]() | Family a.90.1.0: automated matches [274641] (1 protein) not a true family |
![]() | Protein automated matches [274642] (2 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [274643] (1 PDB entry) |
![]() | Domain d3wwta_: 3wwt A: [274644] automated match to d1bgfa_ complexed with ca |
PDB Entry: 3wwt (more details), 2 Å
SCOPe Domain Sequences for d3wwta_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3wwta_ a.90.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} msqwyelqqldskfleqvhqlyddsfpmeirqylaqwlekqdwehaandvsfatirfhdl lsqlddqysrfslennfllqhnirkskrnlqdnfqedpiqmsmiiysclkeerkilenaq rfn
Timeline for d3wwta_: