Lineage for d4zgjp_ (4zgj P:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1783288Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 1784139Superfamily b.34.4: Electron transport accessory proteins [50090] (5 families) (S)
  5. 1784228Family b.34.4.0: automated matches [191659] (1 protein)
    not a true family
  6. 1784229Protein automated matches [191237] (3 species)
    not a true protein
  7. 1784230Species Comamonas testosteroni [TaxId:285] [193572] (4 PDB entries)
  8. 1784246Domain d4zgjp_: 4zgj P: [274638]
    automated match to d4fm4b_
    complexed with fe; mutant

Details for d4zgjp_

PDB Entry: 4zgj (more details), 2 Å

PDB Description: double mutant h80a/h81a of fe-type nitrile hydratase from comamonas testosteroni ni1
PDB Compounds: (P:) Nitrile hydratase beta subunit

SCOPe Domain Sequences for d4zgjp_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4zgjp_ b.34.4.0 (P:) automated matches {Comamonas testosteroni [TaxId: 285]}
mdgmhdlggkqgfgpvikthnakafheewevkmnaisgalvskgiynmdeyrhgiermep
rhyltasyfervfttavtlciekgvftaaeleaklgtsvplslpsspgrqppkgpeggfk
lgqrvhvknefvpghtrfpayirgkagvvvgispaypypdaaahgeygfseptydvcfks
kdlwpdgceaadvhvgvfqsyllsae

SCOPe Domain Coordinates for d4zgjp_:

Click to download the PDB-style file with coordinates for d4zgjp_.
(The format of our PDB-style files is described here.)

Timeline for d4zgjp_: