Lineage for d1vbtb_ (1vbt B:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1801476Fold b.62: Cyclophilin-like [50890] (1 superfamily)
    barrel, closed; n=8, S=10; complex topology
  4. 1801477Superfamily b.62.1: Cyclophilin-like [50891] (5 families) (S)
  5. 1801478Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (13 proteins)
    automatically mapped to Pfam PF00160
  6. 1801479Protein Cyclophilin (eukaryotic) [50893] (13 species)
  7. 1801494Species Human (Homo sapiens), variant A [TaxId:9606] [50894] (78 PDB entries)
    Uniprot P05092
  8. 1801590Domain d1vbtb_: 1vbt B: [27463]

Details for d1vbtb_

PDB Entry: 1vbt (more details), 2.3 Å

PDB Description: Structure of cyclophilin complexed with sulfur-substituted tetrapeptide AAPF
PDB Compounds: (B:) cyclophilin a

SCOPe Domain Sequences for d1vbtb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vbtb_ b.62.1.1 (B:) Cyclophilin (eukaryotic) {Human (Homo sapiens), variant A [TaxId: 9606]}
vnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgfm
cqggdftrhngtggksiygekfedenfilkhtgpgilsmanagpntngsqffictaktew
ldgkhvvfgkvkegmniveamerfgsrngktskkitiadcgqle

SCOPe Domain Coordinates for d1vbtb_:

Click to download the PDB-style file with coordinates for d1vbtb_.
(The format of our PDB-style files is described here.)

Timeline for d1vbtb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1vbta_