Lineage for d4zgeb_ (4zge B:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2053585Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2054490Superfamily b.34.4: Electron transport accessory proteins [50090] (5 families) (S)
  5. 2054583Family b.34.4.0: automated matches [191659] (1 protein)
    not a true family
  6. 2054584Protein automated matches [191237] (4 species)
    not a true protein
  7. 2054585Species Comamonas testosteroni [TaxId:285] [193572] (4 PDB entries)
  8. 2054610Domain d4zgeb_: 4zge B: [274623]
    automated match to d4fm4b_
    complexed with fe; mutant

Details for d4zgeb_

PDB Entry: 4zge (more details), 2.8 Å

PDB Description: double mutant h80w/h81w of fe-type nitrile hydratase from comamonas testosteroni ni1
PDB Compounds: (B:) Nitrile hydratase beta subunit

SCOPe Domain Sequences for d4zgeb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4zgeb_ b.34.4.0 (B:) automated matches {Comamonas testosteroni [TaxId: 285]}
mdgmhdlggkqgfgpvikthnakafheewevkmnaisgalvskgiynmdeyrhgiermep
rhyltasyfervfttavtlciekgvftaaeleaklgtsvplslpsspgrqppkgpeggfk
lgqrvhvknefvpghtrfpayirgkagvvvgispaypypdaaahgeygfseptydvcfks
kdlwpdgceaadvhvgvfqsyllsae

SCOPe Domain Coordinates for d4zgeb_:

Click to download the PDB-style file with coordinates for d4zgeb_.
(The format of our PDB-style files is described here.)

Timeline for d4zgeb_: