Class b: All beta proteins [48724] (177 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.4: Electron transport accessory proteins [50090] (5 families) |
Family b.34.4.0: automated matches [191659] (1 protein) not a true family |
Protein automated matches [191237] (4 species) not a true protein |
Species Comamonas testosteroni [TaxId:285] [193572] (4 PDB entries) |
Domain d4zgdl_: 4zgd L: [274620] automated match to d4fm4b_ complexed with fe; mutant |
PDB Entry: 4zgd (more details), 2.25 Å
SCOPe Domain Sequences for d4zgdl_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4zgdl_ b.34.4.0 (L:) automated matches {Comamonas testosteroni [TaxId: 285]} mdgmhdlggkqgfgpvikthnakafheewevkmnaisgalvskgiynmdeyrhgiermep rhyltasyfervfttavtlciekgvftaaeleaklgtsvplslpsspgrqppkgpeggfk lgqrvhvknefvpghtrfpayirgkagvvvgispaypypdaaahgeygfseptydvcfks kdlwpdgceaadvhvgvfqsyllsae
Timeline for d4zgdl_: