SCOPe 2.08: Domain d4zakc2: 4zak C:116-204

Lineage for d4zakc2 (4zak C:116-204)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein T-cell antigen receptor [49125] (7 species)

7. Species Human (Homo sapiens), beta-chain [TaxId:9606] [49129] (46 PDB entries)

8. Domain d4zakc2: 4zak C:116-204 [274609]
   Other proteins in same PDB: d4zaka1, d4zaka2, d4zakb_, d4zakc1, d4zakd1, d4zakd2
   automated match to d2pyfa2
   complexed with 4lx, nag

Details for d4zakc2

PDB Entry: 4zak, 2.82 Å

PDB Description: crystal structure of the mcd1d/db06-1/inktcr ternary complex

PDB Compounds: (C:) Protein Trav11,Va14Ja18/Vb8.2,Human nkt tcr alpha chain

SCOPe Domain Sequences for d4zakc2:

Sequence; same for both SEQRES and ATOM records:

>d4zakc2 b.1.1.2 (C:116-204) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtffps

Timeline for d4zakc2:

• d4zakc2 first appeared in SCOPe 2.05
  
• d4zakc2 appears in SCOPe 2.07