Lineage for d4zakc1 (4zak C:2-115)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2355236Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2355237Protein automated matches [190740] (24 species)
    not a true protein
  7. 2355363Species Human (Homo sapiens) [TaxId:9606] [187920] (1030 PDB entries)
  8. 2357266Domain d4zakc1: 4zak C:2-115 [274608]
    Other proteins in same PDB: d4zaka1, d4zakb_, d4zakc2
    automated match to d2pyfa1
    complexed with 4lx, nag

Details for d4zakc1

PDB Entry: 4zak (more details), 2.82 Å

PDB Description: crystal structure of the mcd1d/db06-1/inktcr ternary complex
PDB Compounds: (C:) Protein Trav11,Va14Ja18/Vb8.2,Human nkt tcr alpha chain

SCOPe Domain Sequences for d4zakc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4zakc1 b.1.1.0 (C:2-115) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tqveqspqslvvrqgencvlqcnysvtpdnhlrwfkqdtgkglvsltvlvdqkdktsngr
ysatldkdakhstlhitatllddtatyicvvgdrgsalgrlhfgagtqlivipd

SCOPe Domain Coordinates for d4zakc1:

Click to download the PDB-style file with coordinates for d4zakc1.
(The format of our PDB-style files is described here.)

Timeline for d4zakc1: