SCOPe 2.07: Domain d4zaka2: 4zak A:186-279

Lineage for d4zaka2 (4zak A:186-279)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (29 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (822 PDB entries)

8. Domain d4zaka2: 4zak A:186-279 [274606]
   Other proteins in same PDB: d4zaka1, d4zakb_, d4zakc2
   automated match to d3hujc2
   complexed with 4lx, nag

Details for d4zaka2

PDB Entry: 4zak, 2.82 Å

PDB Description: crystal structure of the mcd1d/db06-1/inktcr ternary complex

PDB Compounds: (A:) Antigen-presenting glycoprotein CD1d1

SCOPe Domain Sequences for d4zaka2:

Sequence, based on SEQRES records:

>d4zaka2 b.1.1.0 (A:186-279) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qekpvawlssvpssahghrqlvchvsgfypkpvwvmwmrgdqeqqgthrgdflpnadetw
ylqatldveageeaglacrvkhsslggqdiilyw

Sequence, based on observed residues (ATOM records):

>d4zaka2 b.1.1.0 (A:186-279) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qekpvawlssvprqlvchvsgfypkpvwvmwmrgdqeqqgthrgdflpnadetwylqatl
dveageeaglacrvkhsslggqdiilyw

Timeline for d4zaka2:

• d4zaka2 first appeared in SCOPe 2.05
  
• d4zaka2 appears in SCOPe 2.06
  
• d4zaka2 appears in the current release, SCOPe 2.08