SCOPe 2.06: Domain d4zaka1: 4zak A:7-185

Lineage for d4zaka1 (4zak A:7-185)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein CD1, alpha-1 and alpha-2 domains [54456] (5 species)
   Class I MHC-related

7. Species Mouse (Mus musculus) [TaxId:10090] [54457] (25 PDB entries)

8. Domain d4zaka1: 4zak A:7-185 [274605]
   Other proteins in same PDB: d4zaka2, d4zakb_, d4zakc1, d4zakc2, d4zakd1, d4zakd2
   automated match to d3hujc1
   complexed with 4lx, nag

Details for d4zaka1

PDB Entry: 4zak, 2.82 Å

PDB Description: crystal structure of the mcd1d/db06-1/inktcr ternary complex

PDB Compounds: (A:) Antigen-presenting glycoprotein CD1d1

SCOPe Domain Sequences for d4zaka1:

Sequence; same for both SEQRES and ATOM records:

>d4zaka1 d.19.1.1 (A:7-185) CD1, alpha-1 and alpha-2 domains {Mouse (Mus musculus) [TaxId: 10090]}
nytfrclqmssfanrswsrtdsvvwlgdlqthrwsndsatisftkpwsqgklsnqqwekl
qhmfqvyrvsftrdiqelvkmmspkedypieiqlsagcemypgnasesflhvafqgkyvv
rfwgtswqtvpgapswldlpikvlnadqgtsatvqmllndtcplfvrglleagksdlek

Timeline for d4zaka1:

• d4zaka1 first appeared in SCOPe 2.05
  
• d4zaka1 appears in SCOPe 2.07
  
• d4zaka1 appears in the current release, SCOPe 2.08