Lineage for d4z17a1 (4z17 A:1-141)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2947581Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 2947582Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 2947878Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 2947879Protein automated matches [226922] (95 species)
    not a true protein
  7. 2948053Species Chloroflexus aurantiacus [TaxId:324602] [274582] (3 PDB entries)
  8. 2948058Domain d4z17a1: 4z17 A:1-141 [274600]
    Other proteins in same PDB: d4z17a2, d4z17b2
    automated match to d3qtpa1
    complexed with mg, pep

Details for d4z17a1

PDB Entry: 4z17 (more details), 2.65 Å

PDB Description: thermostable enolase from chloroflexus aurantiacus
PDB Compounds: (A:) enolase

SCOPe Domain Sequences for d4z17a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4z17a1 d.54.1.0 (A:1-141) automated matches {Chloroflexus aurantiacus [TaxId: 324602]}
mstlieaivarevldsrgnptievdvrlesgdvgraivpsgastgahealelrdgdksry
ngkgvlkavqavnediaealigfdaadqialdqelialdgtpnksklganailgvslaaa
kaaaaafglplyrylggvyah

SCOPe Domain Coordinates for d4z17a1:

Click to download the PDB-style file with coordinates for d4z17a1.
(The format of our PDB-style files is described here.)

Timeline for d4z17a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4z17a2