Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) |
Family d.54.1.0: automated matches [227195] (1 protein) not a true family |
Protein automated matches [226922] (95 species) not a true protein |
Species Chloroflexus aurantiacus [TaxId:324602] [274582] (3 PDB entries) |
Domain d4z1ya1: 4z1y A:2-141 [274598] Other proteins in same PDB: d4z1ya2, d4z1yb2 automated match to d3qtpa1 complexed with 2pg, mg |
PDB Entry: 4z1y (more details), 2.53 Å
SCOPe Domain Sequences for d4z1ya1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4z1ya1 d.54.1.0 (A:2-141) automated matches {Chloroflexus aurantiacus [TaxId: 324602]} stlieaivarevldsrgnptievdvrlesgdvgraivpsgastgahealelrdgdksryn gkgvlkavqavnediaealigfdaadqialdqelialdgtpnksklganailgvslaaak aaaaafglplyrylggvyah
Timeline for d4z1ya1: