Lineage for d4z1yb2 (4z1y B:142-426)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2086988Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. 2087392Family c.1.11.0: automated matches [227196] (1 protein)
    not a true family
  6. 2087393Protein automated matches [226923] (73 species)
    not a true protein
  7. 2087507Species Chloroflexus aurantiacus [TaxId:324602] [274584] (3 PDB entries)
  8. 2087511Domain d4z1yb2: 4z1y B:142-426 [274595]
    Other proteins in same PDB: d4z1ya1, d4z1yb1
    automated match to d3qtpa2
    complexed with 2pg, mg

Details for d4z1yb2

PDB Entry: 4z1y (more details), 2.53 Å

PDB Description: thermostable enolase from chloroflexus aurantiacus with substrate 2- phosphoglycerate
PDB Compounds: (B:) enolase

SCOPe Domain Sequences for d4z1yb2:

Sequence, based on SEQRES records: (download)

>d4z1yb2 c.1.11.0 (B:142-426) automated matches {Chloroflexus aurantiacus [TaxId: 324602]}
vlpvpmmnimnggqhatnstdfqefmimpvgaesfreglrwgaeiyhmlkkvihdrgfst
tvgdeggfapslptndaplqlimeaiekagyrpgeqivialdpatteifedgkyhlkreg
rslssaemvdywvdlvnrypiisledglaeddwegwallraklgdrvqlvgddflvtnvq
rlqraieakaansiliklnqigsltetlsaiqlaqrsgwtavvshrsgesedvtiadlvv
atnagqiktgapartdriakynqllrieeelgsaaryagrsafkv

Sequence, based on observed residues (ATOM records): (download)

>d4z1yb2 c.1.11.0 (B:142-426) automated matches {Chloroflexus aurantiacus [TaxId: 324602]}
vlpvpmmnimnggqhatnstdfqefmimpvgaesfreglrwgaeiyhmlkkvihdrgfst
tvgdeggfapslptndaplqlimeaiekagyrpgeqivialdpatteihlkregrslssa
emvdywvdlvnrypiisledglaeddwegwallraklgdrvqlvgddflvtnvqrlqrai
eakaansiliklnqigsltetlsaiqlaqrsgwtavvshrsgesedvtiadlvvatnagq
iktgapartdriakynqllrieeelgsaaryagrsafkv

SCOPe Domain Coordinates for d4z1yb2:

Click to download the PDB-style file with coordinates for d4z1yb2.
(The format of our PDB-style files is described here.)

Timeline for d4z1yb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4z1yb1