SCOP 1.59: Domain d1cwia_: 1cwi A:

Lineage for d1cwia_ (1cwi A:)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.62: Cyclophilin (peptidylprolyl isomerase) [50890] (1 superfamily)

4. Superfamily b.62.1: Cyclophilin (peptidylprolyl isomerase) [50891] (1 family)

5. Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (3 proteins)

6. Protein Cyclophilin (eukaryotic) [50893] (7 species)

7. Species Human (Homo sapiens), variant A [TaxId:9606] [50894] (33 PDB entries)

8. Domain d1cwia_: 1cwi A: [27458]

Details for d1cwia_

PDB Entry: 1cwi, 1.9 Å

PDB Description: human cyclophilin a complexed with 2-val 3-(n-methyl)-d-alanine cyclosporin

SCOP Domain Sequences for d1cwia_:

Sequence; same for both SEQRES and ATOM records:

>d1cwia_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Human (Homo sapiens), variant A}
mvnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgf
mcqggdftrhngtggksiygekfedenfilkhtgpgilsmanagpntngsqffictakte
wldgkhvvfgkvkegmniveamerfgsrngktskkitiadcgqle

Timeline for d1cwia_:

• d1cwia_ first appeared (with stable ids) in SCOP 1.55
  
• d1cwia_ appears in SCOP 1.57
  
• d1cwia_ appears in SCOP 1.61
  
• d1cwia_ appears in the current release, SCOPe 2.08