Lineage for d4yhaf_ (4yha F:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2067964Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
    single sheet; 10 strands
  4. 2067965Superfamily b.74.1: Carbonic anhydrase [51069] (2 families) (S)
  5. 2068693Family b.74.1.0: automated matches [191576] (1 protein)
    not a true family
  6. 2068694Protein automated matches [191011] (13 species)
    not a true protein
  7. 2068726Species Helicobacter pylori [TaxId:85962] [274562] (6 PDB entries)
  8. 2068740Domain d4yhaf_: 4yha F: [274577]
    automated match to d1koqa_
    complexed with cl, gol, mzm, zn

Details for d4yhaf_

PDB Entry: 4yha (more details), 2.2 Å

PDB Description: crystal structure of the complex of helicobacter pylori alpha-carbonic anhydrase with methazolamide
PDB Compounds: (F:) Alpha-carbonic anhydrase

SCOPe Domain Sequences for d4yhaf_:

Sequence, based on SEQRES records: (download)

>d4yhaf_ b.74.1.0 (F:) automated matches {Helicobacter pylori [TaxId: 85962]}
wdyknkengphrwdklhkdfevcksgksqspiniehyyhtqdkadlqfkyaaskpkavff
thhtlkasfeptnhinyrghdyvldnvhfhapmeflinnktrplsahfvhkdakgrllvl
aigfeegkenpnldpilegiqkkqnfkevaldaflpksinyyhfngsltappctegvawf
vieeplevsakqlaeikkrmknspnqrpvqpdyntviikssaetr

Sequence, based on observed residues (ATOM records): (download)

>d4yhaf_ b.74.1.0 (F:) automated matches {Helicobacter pylori [TaxId: 85962]}
wdyknkengphrwdklhkdfevcksgksqspiniehyyhtqdkadlqfkyaaskpkavff
thhtlkasfeptnhinyrghdyvldnvhfhapmeflinnktrplsahfvhkdakgrllvl
aigfeeenpnldpilegiqkkdaflpksinyyhfngsltappctegvawfvieeplevsa
kqlaeikkrmknspnqrpvqpdyntviikssaetr

SCOPe Domain Coordinates for d4yhaf_:

Click to download the PDB-style file with coordinates for d4yhaf_.
(The format of our PDB-style files is described here.)

Timeline for d4yhaf_: