Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 proteins) also known as short-chain dehydrogenases and SDR family parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7 |
Protein Sepiapterin reductase [51767] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [141874] (6 PDB entries) Uniprot P35270 5-261 |
Domain d4xwyb_: 4xwy B: [274554] automated match to d1z6zb_ complexed with 43o, ndp, so4 |
PDB Entry: 4xwy (more details), 2.35 Å
SCOPe Domain Sequences for d4xwyb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4xwyb_ c.2.1.2 (B:) Sepiapterin reductase {Human (Homo sapiens) [TaxId: 9606]} glgravclltgasrgfgrtlapllasllspgsvlvlsarndealrqleaelgaersglrv vrvpadlgaeaglqqllgalrelprpkglqrlllinnagslgdvskgfvdlsdstqvnny walnltsmlcltssvlkafpdspglnrtvvnisslcalqpfkgwalycagkaardmlfqv laleepnvrvlnyapgpldtdmqqlaretsvdpdmrkglqelkakgklvdckvsaqklls llekdefksgahvdfyd
Timeline for d4xwyb_: