SCOPe 2.07: Domain d3x0eb_: 3x0e B:

Lineage for d3x0eb_ (3x0e B:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.135: Tetraspanin [48651] (1 superfamily)
   5 helices: irregular disulfide-linked array; form homodimer

4. Superfamily a.135.1: Tetraspanin [48652] (1 family)

5. Family a.135.1.1: Tetraspanin [48653] (2 protein domains)

6. Protein automated matches [256548] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [256549] (11 PDB entries)

8. Domain d3x0eb_: 3x0e B: [274544]
   automated match to d4bkha_
   complexed with mg

Details for d3x0eb_

PDB Entry: 3x0e, 1.84 Å

PDB Description: crystal structure of the ectodomain of human cd81 large extracellular loop (hcd81-lel)

PDB Compounds: (B:) CD81 antigen

SCOPe Domain Sequences for d3x0eb_:

Sequence, based on SEQRES records:

>d3x0eb_ a.135.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fvnkdqiakdvkqfydqalqqavvdddannakavvktfhetldccgsstltalttsvlkn
nlcpsgsniisnlfkedchqkiddlfsgk

Sequence, based on observed residues (ATOM records):

>d3x0eb_ a.135.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fvnkdqiakdvkqfydqalqqavvdddannakavvktfhetldccgsstltalttsvlkn
nlcpniisnlfkedchqkiddlfsgk

Timeline for d3x0eb_:

• d3x0eb_ first appeared in SCOPe 2.05
  
• d3x0eb_ appears in SCOPe 2.06