![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.135: Tetraspanin [48651] (1 superfamily) 5 helices: irregular disulfide-linked array; form homodimer |
![]() | Superfamily a.135.1: Tetraspanin [48652] (1 family) ![]() |
![]() | Family a.135.1.1: Tetraspanin [48653] (2 proteins) |
![]() | Protein automated matches [256548] (3 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [256549] (15 PDB entries) |
![]() | Domain d3x0ea_: 3x0e A: [274539] automated match to d4bkha_ complexed with mg |
PDB Entry: 3x0e (more details), 1.84 Å
SCOPe Domain Sequences for d3x0ea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3x0ea_ a.135.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} fvnkdqiakdvkqfydqalqqavvdddannakavvktfhetldccgsstltalttsvlkn nlcpsgsniisnlfkedchqkiddlfsgk
Timeline for d3x0ea_: