Lineage for d3x0fb_ (3x0f B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2733570Fold a.135: Tetraspanin [48651] (1 superfamily)
    5 helices: irregular disulfide-linked array; form homodimer
  4. 2733571Superfamily a.135.1: Tetraspanin [48652] (1 family) (S)
  5. 2733572Family a.135.1.1: Tetraspanin [48653] (2 proteins)
  6. 2733579Protein automated matches [256548] (3 species)
    not a true protein
  7. 2733621Species Mouse (Mus musculus) [TaxId:10090] [274536] (1 PDB entry)
  8. 2733623Domain d3x0fb_: 3x0f B: [274538]
    automated match to d4bkha_
    complexed with ipa

Details for d3x0fb_

PDB Entry: 3x0f (more details), 1.47 Å

PDB Description: crystal structure of the ectodomain of mouse cd81 large extracellular loop (mcd81-lel)
PDB Compounds: (B:) CD81 antigen

SCOPe Domain Sequences for d3x0fb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3x0fb_ a.135.1.1 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
fvnkdqiakdvkqfydqalqqavmdddannakavvktfhetlnccgsnalttltttilrn
slcpsggniltpllqqdchqkidelfsg

SCOPe Domain Coordinates for d3x0fb_:

Click to download the PDB-style file with coordinates for d3x0fb_.
(The format of our PDB-style files is described here.)

Timeline for d3x0fb_: