Lineage for d4wyjc_ (4wyj C:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2048516Fold b.21: Virus attachment protein globular domain [49834] (1 superfamily)
    sandwich, 10 strands in 2 sheets; greek-key
  4. 2048517Superfamily b.21.1: Virus attachment protein globular domain [49835] (4 families) (S)
  5. 2048518Family b.21.1.1: Adenovirus fiber protein "knob" domain [49836] (2 proteins)
    automatically mapped to Pfam PF00541
  6. 2048519Protein Adenovirus fiber protein "knob" domain [49837] (12 species)
  7. 2048576Species Human adenovirus b serotype 3 [TaxId:45659] [274530] (1 PDB entry)
  8. 2048579Domain d4wyjc_: 4wyj C: [274533]
    automated match to d3cnca_
    complexed with so4; mutant

Details for d4wyjc_

PDB Entry: 4wyj (more details), 2.65 Å

PDB Description: adenovirus 3 head domain mutant v239d
PDB Compounds: (C:) fiber protein

SCOPe Domain Sequences for d4wyjc_:

Sequence, based on SEQRES records: (download)

>d4wyjc_ b.21.1.1 (C:) Adenovirus fiber protein "knob" domain {Human adenovirus b serotype 3 [TaxId: 45659]}
knntlwtgpkpeanciieygkqnpdskltlilvknggivngyvtlmgasdyvntlfknkn
vsinvelyfdatghilpdssslktdlelkykqtadfsargfmpsttaypfdlpnagthne
nyifgqcyykasdgalfplevtvmlnkrlpdsrtsyvmtflwslnaglapettqatlits
pftfsyiredd

Sequence, based on observed residues (ATOM records): (download)

>d4wyjc_ b.21.1.1 (C:) Adenovirus fiber protein "knob" domain {Human adenovirus b serotype 3 [TaxId: 45659]}
knntlwtgpkpeanciieygkqnpdskltlilvknggivngyvtlmgasdyvntlfknkn
vsinvelyfdatghilpdssslktdlelkykdfsargfmpsttaypfdlpnagthnenyi
fgqcyykasdgalfplevtvmlnkrlpdsrtsyvmtflwslnaglapettqatlitspft
fsyiredd

SCOPe Domain Coordinates for d4wyjc_:

Click to download the PDB-style file with coordinates for d4wyjc_.
(The format of our PDB-style files is described here.)

Timeline for d4wyjc_: