Lineage for d4wyjb_ (4wyj B:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1778904Fold b.21: Virus attachment protein globular domain [49834] (1 superfamily)
    sandwich, 10 strands in 2 sheets; greek-key
  4. 1778905Superfamily b.21.1: Virus attachment protein globular domain [49835] (4 families) (S)
  5. 1778906Family b.21.1.1: Adenovirus fiber protein "knob" domain [49836] (2 proteins)
    automatically mapped to Pfam PF00541
  6. 1778907Protein Adenovirus fiber protein "knob" domain [49837] (12 species)
  7. 1778964Species Human adenovirus b serotype 3 [TaxId:45659] [274530] (1 PDB entry)
  8. 1778966Domain d4wyjb_: 4wyj B: [274532]
    automated match to d3cnca_
    complexed with so4; mutant

Details for d4wyjb_

PDB Entry: 4wyj (more details), 2.65 Å

PDB Description: adenovirus 3 head domain mutant v239d
PDB Compounds: (B:) fiber protein

SCOPe Domain Sequences for d4wyjb_:

Sequence, based on SEQRES records: (download)

>d4wyjb_ b.21.1.1 (B:) Adenovirus fiber protein "knob" domain {Human adenovirus b serotype 3 [TaxId: 45659]}
knntlwtgpkpeanciieygkqnpdskltlilvknggivngyvtlmgasdyvntlfknkn
vsinvelyfdatghilpdssslktdlelkykqtadfsargfmpsttaypfdlpnagthne
nyifgqcyykasdgalfplevtvmlnkrlpdsrtsyvmtflwslnaglapettqatlits
pftfsyiredd

Sequence, based on observed residues (ATOM records): (download)

>d4wyjb_ b.21.1.1 (B:) Adenovirus fiber protein "knob" domain {Human adenovirus b serotype 3 [TaxId: 45659]}
knntlwtgpkpeanciieygkqnpdskltlilvknggivngyvtlmgasdyvntlfknkn
vsinvelyfdatghilpdssslktdlelkykadfsargfmpsttaypfdlpnagthneny
ifgqcyykasdgalfplevtvmlnkrlpdsrtsyvmtflwslnaglapettqatlitspf
tfsyiredd

SCOPe Domain Coordinates for d4wyjb_:

Click to download the PDB-style file with coordinates for d4wyjb_.
(The format of our PDB-style files is described here.)

Timeline for d4wyjb_: