SCOPe 2.06: Domain d4wyja_: 4wyj A:

Lineage for d4wyja_ (4wyj A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.21: Virus attachment protein globular domain [49834] (1 superfamily)
   sandwich, 10 strands in 2 sheets; greek-key

4. Superfamily b.21.1: Virus attachment protein globular domain [49835] (4 families)

5. Family b.21.1.1: Adenovirus fiber protein "knob" domain [49836] (2 proteins)
   automatically mapped to Pfam PF00541

6. Protein Adenovirus fiber protein "knob" domain [49837] (12 species)

7. Species Human adenovirus b serotype 3 [TaxId:45659] [274530] (1 PDB entry)

8. Domain d4wyja_: 4wyj A: [274531]
   automated match to d3cnca_
   complexed with so4; mutant

Details for d4wyja_

PDB Entry: 4wyj, 2.65 Å

PDB Description: adenovirus 3 head domain mutant v239d

PDB Compounds: (A:) fiber protein

SCOPe Domain Sequences for d4wyja_:

Sequence, based on SEQRES records:

>d4wyja_ b.21.1.1 (A:) Adenovirus fiber protein "knob" domain {Human adenovirus b serotype 3 [TaxId: 45659]}
knntlwtgpkpeanciieygkqnpdskltlilvknggivngyvtlmgasdyvntlfknkn
vsinvelyfdatghilpdssslktdlelkykqtadfsargfmpsttaypfdlpnagthne
nyifgqcyykasdgalfplevtvmlnkrlpdsrtsyvmtflwslnaglapettqatlits
pftfsyiredd

Sequence, based on observed residues (ATOM records):

>d4wyja_ b.21.1.1 (A:) Adenovirus fiber protein "knob" domain {Human adenovirus b serotype 3 [TaxId: 45659]}
knntlwtgpkpeanciieygkqnpdskltlilvknggivngyvtlmgasdyvntlfknkn
vsinvelyfdatghilpdssslktdlelkykadfsargfmpsttaypfdlpnagthneny
ifgqcyykasdgalfplevtvmlnkrlpdsrtsyvmtflwslnaglapettqatlitspf
tfsyiredd

Timeline for d4wyja_:

• d4wyja_ first appeared in SCOPe 2.05
  
• d4wyja_ appears in SCOPe 2.07
  
• d4wyja_ appears in the current release, SCOPe 2.08