SCOPe 2.07: Domain d4ub7a_: 4ub7 A:

Lineage for d4ub7a_ (4ub7 A:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein Protein kinase CK2, alpha subunit [56142] (3 species)
   CMGC group; CK2 subfamily; serine/threonine kinase

7. Species Human (Homo sapiens) [TaxId:9606] [75559] (180 PDB entries)

8. Domain d4ub7a_: 4ub7 A: [274521]
   automated match to d3juha_
   complexed with 3g5, cl

Details for d4ub7a_

PDB Entry: 4ub7, 2.1 Å

PDB Description: high-salt structure of protein kinase ck2 catalytic subunit with 4'- carboxy-6,8-bromo-flavonol (flc26) showing an extreme distortion of the atp-binding loop combined with a pi-halogen bond

PDB Compounds: (A:) Casein kinase II subunit alpha

SCOPe Domain Sequences for d4ub7a_:

Sequence; same for both SEQRES and ATOM records:

>d4ub7a_ d.144.1.7 (A:) Protein kinase CK2, alpha subunit {Human (Homo sapiens) [TaxId: 9606]}
sgpvpsrarvytdvnthrpreywdyeshvvewgnqddyqlvrklgrgkysevfeainitn
nekvvvkilkpvkkkkikreikilenlrggpniitladivkdpvsrtpalvfehvnntdf
kqlyqtltdydirfymyeilkaldychsmgimhrdvkphnvmidhehrklrlidwglaef
yhpgqeynvrvasryfkgpellvdyqmydysldmwslgcmlasmifrkepffhghdnydq
lvriakvlgtedlydyidkynieldprfndilgrhsrkrwerfvhsenqhlvspealdfl
dkllrydhqsrltareamehpyfytvvkdqarmg

Timeline for d4ub7a_:

• d4ub7a_ first appeared in SCOPe 2.05
  
• d4ub7a_ appears in SCOPe 2.06
  
• d4ub7a_ appears in the current release, SCOPe 2.08