SCOPe 2.06: Domain d4w64a1: 4w64 A:1-167

Lineage for d4w64a1 (4w64 A:1-167)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.157: Hcp1-like [141451] (1 superfamily)
   barrel, closed; n=6, S=12; contains extra, non-barrel strand 7 at the C-terminus

4. Superfamily b.157.1: Hcp1-like [141452] (2 families)
   probable biological unit is a ring-like hexamer containing a 24-stranded beta-barrel made of the subunit beta-sheets

5. Family b.157.1.0: automated matches [191591] (1 protein)
   not a true family

6. Protein automated matches [191065] (5 species)
   not a true protein

7. Species Acinetobacter baumannii [TaxId:480119] [274514] (1 PDB entry)

8. Domain d4w64a1: 4w64 A:1-167 [274516]
   Other proteins in same PDB: d4w64a2, d4w64a3, d4w64b2, d4w64b3
   automated match to d4tv4a_
   complexed with so4

Details for d4w64a1

PDB Entry: 4w64, 1.55 Å

PDB Description: hcp1 protein from acinetobacter baumannii ab0057

PDB Compounds: (A:) Type VI secretion system effector, Hcp1 family

SCOPe Domain Sequences for d4w64a1:

Sequence; same for both SEQRES and ATOM records:

>d4w64a1 b.157.1.0 (A:1-167) automated matches {Acinetobacter baumannii [TaxId: 480119]}
mkdiyvefrgkykvdgesrdsehkgwlevnswshnirqpksatsssvgghtaervehsdm
vfvkdldatspklweacsagytfdevqidfyrangdkrikylqiklkhvlvssvtptvne
egvpteafglkyaavewtynqqdingtakgavtkkwslsnntasyaa

Timeline for d4w64a1:

• d4w64a1 first appeared in SCOPe 2.05, called d4w64a_
  
• d4w64a1 appears in SCOPe 2.07
  
• d4w64a1 appears in the current release, SCOPe 2.08