Lineage for d4ts8a_ (4ts8 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1993780Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 1993781Superfamily a.29.2: Bromodomain [47370] (2 families) (S)
  5. 1993782Family a.29.2.1: Bromodomain [47371] (5 proteins)
  6. 1993783Protein CREB-binding protein, CBP [74712] (1 species)
  7. 1993784Species Human (Homo sapiens) [TaxId:9606] [74713] (10 PDB entries)
  8. 1993790Domain d4ts8a_: 4ts8 A: [274513]
    automated match to d3p1fa_
    complexed with edo, xz8

Details for d4ts8a_

PDB Entry: 4ts8 (more details), 2 Å

PDB Description: crystal structure of the bromodomain of human crebbp in complex with xz08
PDB Compounds: (A:) creb-binding protein

SCOPe Domain Sequences for d4ts8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ts8a_ a.29.2.1 (A:) CREB-binding protein, CBP {Human (Homo sapiens) [TaxId: 9606]}
fkpeelrqalmptlealyrqdpeslpfrqpvdpqllgipdyfdivknpmdlstikrkldt
gqyqepwqyvddvwlmfnnawlynrktsrvykfcsklaevfeqeidpvmqsl

SCOPe Domain Coordinates for d4ts8a_:

Click to download the PDB-style file with coordinates for d4ts8a_.
(The format of our PDB-style files is described here.)

Timeline for d4ts8a_: