Lineage for d4ts6a_ (4ts6 A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2045100Fold b.7: C2 domain-like [49561] (5 superfamilies)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 2045101Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (3 families) (S)
    two constituent families are related by circular permutation
  5. 2045347Family b.7.1.0: automated matches [191388] (1 protein)
    not a true family
  6. 2045348Protein automated matches [190497] (4 species)
    not a true protein
  7. 2045349Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [274511] (1 PDB entry)
  8. 2045350Domain d4ts6a_: 4ts6 A: [274512]
    automated match to d1rh8a_
    complexed with gol

Details for d4ts6a_

PDB Entry: 4ts6 (more details), 1.92 Å

PDB Description: crystal structure of the rim c2a domain from drosophila.
PDB Compounds: (A:) Rab3 interacting molecule variant 2

SCOPe Domain Sequences for d4ts6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ts6a_ b.7.1.0 (A:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
piegrlqlklgydqntlqlivtlvcatglslrqsgagrnpyakvfllpdrshkskrrtkt
vgttceprwgqtfvysglrrcdlngrllevtlwdyvrygandfigevvidlahhilddea
ewyqlq

SCOPe Domain Coordinates for d4ts6a_:

Click to download the PDB-style file with coordinates for d4ts6a_.
(The format of our PDB-style files is described here.)

Timeline for d4ts6a_: