Class b: All beta proteins [48724] (180 folds) |
Fold b.7: C2 domain-like [49561] (5 superfamilies) sandwich; 8 strands in 2 sheets; greek-key |
Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (4 families) two constituent families are related by circular permutation |
Family b.7.1.0: automated matches [191388] (1 protein) not a true family |
Protein automated matches [190497] (4 species) not a true protein |
Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [274511] (1 PDB entry) |
Domain d4ts6a_: 4ts6 A: [274512] automated match to d1rh8a_ complexed with gol |
PDB Entry: 4ts6 (more details), 1.92 Å
SCOPe Domain Sequences for d4ts6a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ts6a_ b.7.1.0 (A:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} piegrlqlklgydqntlqlivtlvcatglslrqsgagrnpyakvfllpdrshkskrrtkt vgttceprwgqtfvysglrrcdlngrllevtlwdyvrygandfigevvidlahhilddea ewyqlq
Timeline for d4ts6a_: