Lineage for d4qmua_ (4qmu A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2586062Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2586063Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2591262Family d.144.1.0: automated matches [191359] (1 protein)
    not a true family
  6. 2591263Protein automated matches [190417] (35 species)
    not a true protein
  7. 2591422Species Human (Homo sapiens) [TaxId:9606] [187294] (1319 PDB entries)
  8. 2591561Domain d4qmua_: 4qmu A: [274494]
    automated match to d3a7hb_
    complexed with dms, mg, ske

Details for d4qmua_

PDB Entry: 4qmu (more details), 1.55 Å

PDB Description: mst3 in complex with jnj-7706621, 4-({5-amino-1-[(2,6-difluorophenyl) carbonyl]-1h-1,2,4-triazol-3-yl}amino)benzenesulfonamide
PDB Compounds: (A:) Serine/threonine-protein kinase 24

SCOPe Domain Sequences for d4qmua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qmua_ d.144.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gmqnlkadpeelftklekigkgsfgevfkgidnrtqkvvaikiidleeaedeiediqqei
tvlsqcdspyvtkyygsylkdtklwiimeylgggsaldllepgpldetqiatilreilkg
ldylhsekkihrdikaanvllsehgevkladfgvagqltdtqikrntfvgtpfwmapevi
kqsaydskadiwslgitaielargepphselhpmkvlflipknnpptlegnyskplkefv
eaclnkepsfrptakellkhkfilrnakktsyltelidrykrwkaeq

SCOPe Domain Coordinates for d4qmua_:

Click to download the PDB-style file with coordinates for d4qmua_.
(The format of our PDB-style files is described here.)

Timeline for d4qmua_: