Lineage for d2rmbe_ (2rmb E:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 468514Fold b.62: Cyclophilin-like [50890] (1 superfamily)
    barrel, closed; n=8, S=10; complex topology
  4. 468515Superfamily b.62.1: Cyclophilin-like [50891] (2 families) (S)
  5. 468516Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (3 proteins)
  6. 468527Protein Cyclophilin (eukaryotic) [50893] (9 species)
  7. 468540Species Human (Homo sapiens), variant A [TaxId:9606] [50894] (42 PDB entries)
  8. 468575Domain d2rmbe_: 2rmb E: [27448]

Details for d2rmbe_

PDB Entry: 2rmb (more details), 2.1 Å

PDB Description: crystal structures of cyclophilin a complexed with cyclosporin a and n-methyl-4-[(e)-2-butenyl]-4,4-dimethylthreonine cyclosporin a

SCOP Domain Sequences for d2rmbe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rmbe_ b.62.1.1 (E:) Cyclophilin (eukaryotic) {Human (Homo sapiens), variant A}
mvnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgf
mcqggdftrhngtggksiygekfedenfilkhtgpgilsmanagpntngsqffictakte
wldgkhvvfgkvkegmniveamerfgsrngktskkitiadcgqle

SCOP Domain Coordinates for d2rmbe_:

Click to download the PDB-style file with coordinates for d2rmbe_.
(The format of our PDB-style files is described here.)

Timeline for d2rmbe_: