Lineage for d4qohb_ (4qoh B:)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
Superfamily c.23.5: Flavoproteins [52218] (9 families) 
Family c.23.5.3: Quinone reductase [52235] (4 proteins)
binds FADProtein Quinone reductase type 2 (menadione reductase) [52240] (1 species) Species Human (Homo sapiens) [TaxId:9606] [52241] (66 PDB entries) 
Domain d4qohb_: 4qoh B: [274474]
automated match to d4fgld_
complexed with fad, gol, stl, zn
Details for d4qohb_
PDB Entry: 4qoh (more details), 1.6 Å
PDB Description: crystal structure of fad quinone reductase 2 in complex with resveratrol at 1.6a
PDB Compounds: (B:) Ribosyldihydronicotinamide dehydrogenase [quinone]SCOPe Domain Sequences for d4qohb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4qohb_ c.23.5.3 (B:) Quinone reductase type 2 (menadione reductase) {Human (Homo sapiens) [TaxId: 9606]}
gkkvlivyahqepksfngslknvavdelsrqgctvtvsdlyamnfepratdkditgtlsn
pevfnygvetheaykqrslasditdeqkkvreadlvifqfplywfsvpailkgwmdrvlc
qgfafdipgfydsgllqgklallsvttggtaemytktgvngdsryflwplqhgtlhfcgf
kvlapqisfapeiaseeerkgmvaawsqrlqtiwkeepipctahwhfg
SCOPe Domain Coordinates for d4qohb_:
Click to download the PDB-style file with coordinates for d4qohb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4qohb_:
- d4qohb_ first appeared in SCOPe 2.05
- d4qohb_ appears in SCOPe 2.07
View in 3D
